Skip to Content
  1. All Products
  2. All Products
  3. Amyloid Beta-Peptide (1-40) (Umano) --> C194H295N53O58S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-COOH Purity: 95% : 10x1mg
-
Amyloid Beta-Peptide (1-40) (Umano) --> C194H295N53O58S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-COOH Purity: 95% : 10x1mg

Amyloid Beta-Peptide (1-40) (Umano) --> C194H295N53O58S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-COOH Purity: 95% : 10x1mg

https://www.spbrain.com/web/image/product.template/48051/image_1920?unique=b745ab1

795.00 € 795.0 EUR 795.00 €

795.00 €

Not Available For Sale

This combination does not exist.

Contact Us

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Share

Website URL: /shop/amyloid-beta-peptide-1-40-umano-c194h295n53o58s1-nh2-daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvv-cooh-purity-95-10x1mg-48051
Display Name: Amyloid Beta-Peptide (1-40) (Umano) --> C194H295N53O58S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-COOH Purity: 95% : 10x1mg