Skip to Content

Amyloid Beta-Peptide (1-42) (Umano) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% : 10x1mg

https://www.spbrain.com/web/image/product.template/48052/image_1920?unique=0dbac67

0.01 € 0.01 EUR 0.01 €

0.01 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Website URL: /shop/amyloid-beta-peptide-1-42-umano-c203h311n55o60s1-nh2-daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvvia-cooh-purity-95-10x1mg-48052
Display Name: Amyloid Beta-Peptide (1-42) (Umano) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% : 10x1mg

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.