Skip to Content
  1. All Products
  2. All Products
  3. FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide; Purity: >98% : 500mg
-
FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide; Purity: >98% : 500mg

FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide; Purity: >98% : 500mg

https://www.spbrain.com/web/image/product.template/51949/image_1920?unique=0dbac67

0.01 € 0.01 EUR 0.01 €

0.01 €

Not Available For Sale

This combination does not exist.

Contact Us

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Share

Website URL: /shop/fvnqhlsgshlvealylvsgergffytpka-synthetic-peptide-purity-98-500mg-51949
Display Name: FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide; Purity: >98% : 500mg